PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02153.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 333aa    MW: 38024.8 Da    PI: 6.7137
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02153.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.32.1e-51111391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+ +yL+kk+++ k++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat+ g+W
  Rsa1.0_02153.1_g00007.1  11 VPPGFRFHPTEEELLEYYLRKKISNIKIDL-DVIRDVDLNKLEPWDIQEmcKIGTtPQNDWYFFSHKDKKYPTGTRTNRATTVGFW 95 
                              69****************************.9***************962433332455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katg+dk ++s +g  +g++ktLvfykgrap+g+k+dW+mheyrl
  Rsa1.0_02153.1_g00007.1  96 KATGRDKIIYS-NGDRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                              ***********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-578176IPR003441NAC domain
PROSITE profilePS5100555.0311176IPR003441NAC domain
PfamPF023651.2E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MKISVNGQSK VPPGFRFHPT EEELLEYYLR KKISNIKIDL DVIRDVDLNK LEPWDIQEMC  60
KIGTTPQNDW YFFSHKDKKY PTGTRTNRAT TVGFWKATGR DKIIYSNGDR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD ENVLASSSNH DDDVSVETCE VIGGDEGWVV CRVFMKKSLC  180
KTVTMSSPPR SVKTSPETIE ELFEVMGQSC KEEITVDPFL KLPNNTIASC QRLMDDQVHN  240
YQVPSFGTSW ATLDRLVASQ LNGPNSYSIP SVDDIPQSPL HGLNRPGFYN TGLTQHYFTT  300
EMDIWNDTDF GRTTTSSSNP YGAMYQTVVN NRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-48817814167NAC domain-containing protein 19
4dul_A5e-48817814167NAC domain-containing protein 19
1ut7_B5e-48817814167NO APICAL MERISTEM PROTEIN
1ut7_A5e-48817814167NO APICAL MERISTEM PROTEIN
1ut4_B5e-48817814167NO APICAL MERISTEM PROTEIN
1ut4_A5e-48817814167NO APICAL MERISTEM PROTEIN
3swp_D6e-48817817170NAC domain-containing protein 19
3swp_C6e-48817817170NAC domain-containing protein 19
3swp_B6e-48817817170NAC domain-containing protein 19
3swp_A6e-48817817170NAC domain-containing protein 19
3swm_D6e-48817817170NAC domain-containing protein 19
3swm_C6e-48817817170NAC domain-containing protein 19
3swm_B6e-48817817170NAC domain-containing protein 19
3swm_A6e-48817817170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00015PBMTransfer from AT3G61910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104354.10.0PREDICTED: NAC domain-containing protein 66-like
SwissprotQ9M2740.0NAC66_ARATH; NAC domain-containing protein 66
TrEMBLA0A078BTB20.0A0A078BTB2_BRANA; BnaA07g19100D protein
TrEMBLM4CGZ50.0M4CGZ5_BRARP; Uncharacterized protein
STRINGBra003478.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61910.11e-174NAC domain protein 66